PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00011.1.g07300.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 230aa    MW: 23451.9 Da    PI: 9.5787
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00011.1.g07300.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.74.5e-374295457
                        zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57
                                  + l+cprC+st+tkfCyynnysl qPr+fCk+CrryWt+GGalrnvPvGgg+r+
  Zjn_sc00011.1.g07300.1.am.mk 42 AGLPCPRCESTDTKFCYYNNYSLGQPRHFCKGCRRYWTRGGALRNVPVGGGTRR 95
                                  6789*************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.4E-314495IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5654498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-174686IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MVRRSAAGAM EAGHQVTEGN ALALVAAAAA GGGGGGGPKE PAGLPCPRCE STDTKFCYYN  60
NYSLGQPRHF CKGCRRYWTR GGALRNVPVG GGTRRGVPAA RRKRPTSASS SSSRASVLPP  120
PPLASSSPAA CYATARPYDL PPFMPALASP VAAVGDPDCR LLDLGGSFTS LLAPAAPDVR  180
FSAGFLMGGL PPVMMPAPPA SSAPSLLPPP VSQALPEGLI WGMGWPDLSI
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703066e-50HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457194.11e-64hypothetical protein SORBIDRAFT_03g003050
TrEMBLC5XLX92e-64C5XLX9_SORBI; Dof-type zinc finger protein 27
STRINGSb03g003050.14e-64(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-22DNA binding with one finger 2.4